CacheBy
Atlas Antibodies Anti-GSTA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSTA1 Antibody

상품 한눈에 보기

Human GSTA1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 sodium azide 포함. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048934-100 Anti-GSTA1 Antibody, glutathione S-transferase alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048934-25 Anti-GSTA1 Antibody, glutathione S-transferase alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSTA1 Antibody

Anti-GSTA1 Antibody

Target: Glutathione S-transferase alpha 1 (GSTA1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GSTA1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Glutathione S-transferase alpha 1
Target Gene GSTA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY
Verified Species Reactivity Human
Interspecies Identity Mouse (79%), Rat (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.