Atlas Antibodies Anti-GSS Antibody

상품 한눈에 보기

Human GSS (glutathione synthetase) 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합하며, Orthogonal 및 Independent validation을 통해 검증됨. PrEST 항원으로 친화 정제된 고품질 항체.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059315-100 Anti-GSS Antibody, glutathione synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059315-25 Anti-GSS Antibody, glutathione synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GSS Antibody

Anti-GSS Antibody

Target: Glutathione synthetase (GSS)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC
Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human GSS
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Glutathione synthetase
Target Gene	GSS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAI
Verified Species Reactivity	Human
Interspecies Identity	Mouse (93%), Rat (91%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.