CacheBy
Atlas Antibodies Anti-GSR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSR Antibody

상품 한눈에 보기

인체 GSR(glutathione reductase)을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 특이적으로 반응하며, 글리세롤 기반 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001538-100 Anti-GSR Antibody, glutathione reductase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001538-25 Anti-GSR Antibody, glutathione reductase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSR Antibody

Anti-GSR Antibody

Target Information

  • Target Protein: Glutathione reductase
  • Target Gene: GSR
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILS

Product Description

Polyclonal antibody against human glutathione reductase (GSR).
Recommended for applications such as immunohistochemistry (IHC).

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000031584): 83%
  • Rat (ENSRNOG00000014915): 80%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.