Atlas Antibodies Anti-GRK7 Antibody
상품 한눈에 보기
Human GRK7 단백질을 인식하는 토끼 폴리클로날 항체로, G protein-coupled receptor kinase 7 검출에 적합. Affinity purification 방식으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRK7 Antibody
제품 개요
- Target Protein: G protein-coupled receptor kinase 7
- Target Gene: GRK7
- Alternative Gene Name: GPRK7
- Host: Rabbit
- Clonality: Polyclonal
- Isotype: IgG
제품 설명
Polyclonal antibody against human GRK7.
This antibody is affinity purified using the PrEST antigen as the affinity ligand.
항원 정보
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSG
검증된 반응 종
- Human
완충액 구성
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
권장 응용
- IHC (Immunohistochemistry) 등 다양한 면역학적 분석에 사용 가능
사용 시 주의사항
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.
정제 방법
- Affinity purified using the PrEST antigen as affinity ligand
참고 문서
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor kinase 7 |
| Target Gene | GRK7 |
| Alternative Gene Name | GPRK7 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Verified Reactivity | Human |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified (PrEST antigen) |
| Application | IHC and related assays |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.