CacheBy
Atlas Antibodies Anti-GRM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRM2 Antibody

상품 한눈에 보기

Human GRM2 단백질을 인식하는 토끼 폴리클로날 항체로, glutamate receptor, metabotropic 2 검출에 적합. IHC 등 다양한 응용 가능. PrEST 항원으로 친화 정제됨. 사람 종에 반응하며 쥐·생쥐와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065166-100 Anti-GRM2 Antibody, glutamate receptor, metabotropic 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065166-25 Anti-GRM2 Antibody, glutamate receptor, metabotropic 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRM2 Antibody

Anti-GRM2 Antibody

Target Information

  • Target Protein: Glutamate receptor, metabotropic 2
  • Target Gene: GRM2
  • Alternative Gene Names: GPRC1B, mGlu2, MGLUR2

Product Description

Polyclonal antibody against human GRM2 (glutamate receptor, metabotropic 2).

  • Immunohistochemistry (IHC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    ITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQES

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Rat (ENSRNOG00000013171) – 97% identity
    • Mouse (ENSMUSG00000023192) – 97% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.