CacheBy
Atlas Antibodies Anti-GRK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRK7 Antibody

상품 한눈에 보기

인간 GRK7 단백질을 인식하는 토끼 유래 폴리클로날 항체로, G protein-coupled receptor kinase 7 연구에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 면역조직화학 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075093-100 Anti-GRK7 Antibody, G protein-coupled receptor kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075093-25 Anti-GRK7 Antibody, G protein-coupled receptor kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRK7 Antibody

Anti-GRK7 Antibody

Target Information

  • Target Protein: G protein-coupled receptor kinase 7
  • Target Gene: GRK7
  • Alternative Gene Names: GPRK7

Product Description

Polyclonal antibody against human GRK7.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSG

Verified Species Reactivity

  • Human
  • Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.