
Atlas Antibodies Anti-WRNIP1 Antibody
인간 WRNIP1 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 WB에서 독립 항체 검증으로 신뢰성 확보. 토끼에서 생산된 IgG 형식, PrEST 항원으로 정제. 인간 반응성 확인 및 높은 종간 상동성 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WRNIP1 Antibody
Werner helicase interacting protein 1
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human WRNIP1
Alternative Gene Names
bA420G6.2, FLJ22526, WHIP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Werner helicase interacting protein 1 |
| Target Gene | WRNIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000017040 (97%), Mouse ENSMUSG00000021400 (97%) |
Antigen Sequence:
YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WRAP53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WSB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRNIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRNIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|