
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WRNIP1 Antibody
상품 한눈에 보기
Human WRNIP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 항체 비교를 통한 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 40% glycerol 기반 PBS buffer에 보존됨.
- 카탈로그번호
- HPA031752-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031752-100 Anti-WRNIP1 Antibody, Werner helicase interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031752-25 Anti-WRNIP1 Antibody, Werner helicase interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WRNIP1 Antibody
Anti-WRNIP1 Antibody
Werner helicase interacting protein 1
Recommended Applications
- IHC Independent Validation: Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human WRNIP1
Alternative Gene Names
bA420G6.2, FLJ22526, WHIP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Werner helicase interacting protein 1 |
| Target Gene | WRNIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021400 (97%), Rat ENSRNOG00000017040 (97%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



