Atlas Antibodies Anti-WRAP53 Antibody

상품 한눈에 보기

인간 WRAP53 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 독립 항체 및 재조합 발현으로 검증 완료. 인간 반응성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023026-100 Anti-WRAP53 Antibody, WD repeat containing, antisense to TP53 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023026-25 Anti-WRAP53 Antibody, WD repeat containing, antisense to TP53 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

WD repeat containing, antisense to TP53

IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human WRAP53

FLJ10385, TCAB1, WDR79

항목	내용
Target Protein	WD repeat containing, antisense to TP53
Target Gene	WRAP53
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYC
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000010520 (81%), Mouse ENSMUSG00000041346 (80%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand