원본
Atlas Antibodies Anti-WDR48 Antibody
상품 한눈에 보기
인간 WDR48 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료 및 생물종 교차 반응성 정보 제공.
- 카탈로그번호
- HPA058015-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058015-100 Anti-WDR48 Antibody, WD repeat domain 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058015-25 Anti-WDR48 Antibody, WD repeat domain 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WDR48 Antibody
Anti-WDR48 Antibody
WD repeat domain 48
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent antibody validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human WDR48
Alternative Gene Names
KIAA1449, P80, SPG60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 48 |
| Target Gene | WDR48 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032512 (100%)
- Rat ENSRNOG00000016942 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.