AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WDR44 Antibody
상품 한눈에 보기
인간 WDR44 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western Blot에 적합. PrEST 항원을 이용한 친화 정제 방식. 높은 종간 보존성(인간-마우스 99%)을 보여 연구 재현성 우수. 글리세롤 기반 완충용액에 보존제 포함.
- 카탈로그번호
- HPA046719-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046719-100 Anti-WDR44 Antibody, WD repeat domain 44 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046719-25 Anti-WDR44 Antibody, WD repeat domain 44 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WDR44 Antibody
Anti-WDR44 Antibody
Target: WD repeat domain 44 (WDR44)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human WDR44.
Alternative Gene Names
- DKFZp686L20145
- RAB11BP
- RPH11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 44 |
| Target Gene | WDR44 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVR |
| Verified Species Reactivity | Human |
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000029068): 99%
- Mouse (ENSMUSG00000036769): 99%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.