CacheBy
Atlas Antibodies Anti-WDR48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDR48 Antibody

상품 한눈에 보기

인간 WDR48 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 검증 완료, 쥐와 생쥐에서도 높은 상동성을 가집니다.

카탈로그번호
HPA038421-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038421-100 Anti-WDR48 Antibody, WD repeat domain 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038421-25 Anti-WDR48 Antibody, WD repeat domain 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDR48 Antibody

Anti-WDR48 Antibody

Target: WD repeat domain 48 (WDR48)
Type: Polyclonal Antibody against Human WDR48


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody targets the human WD repeat domain 48 (WDR48) protein. It is affinity purified using the PrEST antigen as affinity ligand and validated for multiple applications.


Alternative Gene Names

KIAA1449, P80, SPG60

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF

Species Reactivity

Verified Species: Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016942 (100%)
  • Mouse ENSMUSG00000032512 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.