CacheBy
Atlas Antibodies Anti-VWA5B1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWA5B1 Antibody

상품 한눈에 보기

인체 VWA5B1 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 직교 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 휴먼 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA064829-100 Anti-VWA5B1 Antibody, von Willebrand factor A domain containing 5B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064829-25 Anti-VWA5B1 Antibody, von Willebrand factor A domain containing 5B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWA5B1 Antibody

Anti-VWA5B1 Antibody

von Willebrand factor A domain containing 5B1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human VWA5B1.


Alternative Gene Names

  • FLJ32784

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein von Willebrand factor A domain containing 5B1
Target Gene VWA5B1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 동일성
Mouse ENSMUSG00000028753 62%
Rat ENSRNOG00000016553 57%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.