
Atlas Antibodies Anti-VWA5B1 Antibody
상품 한눈에 보기
인체 VWA5B1 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 직교 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 휴먼 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VWA5B1 Antibody
von Willebrand factor A domain containing 5B1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human VWA5B1.
Alternative Gene Names
- FLJ32784
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | von Willebrand factor A domain containing 5B1 |
| Target Gene | VWA5B1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000028753 | 62% |
| Rat | ENSRNOG00000016553 | 57% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-VWA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VWA5A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VWA5B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VWA5B2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VWA5A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.