Atlas Antibodies Anti-VWA7 Antibody
상품 한눈에 보기
Human VWA7 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 기반 PBS 버퍼에 보존제 포함. 인간에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VWA7 Antibody
Target Information
- Target Protein: von Willebrand factor A domain containing 7
- Target Gene: VWA7
- Alternative Gene Names: C6orf27, G7c, NG37
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.
Product Description
- Type: Polyclonal Antibody
- Host: Rabbit
- Isotype: IgG
- Reactivity: Human
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
LVFSVDGLLQKITVRIHGDISSFWIKNPAGVSQGQEEGGGPLGHTRRFGQFWMVTMDDPPQTGTWEIQVTAEDTPGVRVQAQTSLDFLFHFGIPMEDGPHPGLYPLTQPVAG
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000007030 | 84% |
| Rat | ENSRNOG00000000860 | 83% |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-VWA7 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-VWA5B2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-VWA7 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-VWA5A Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-VWA5B1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.