
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VWA7 Antibody
상품 한눈에 보기
Human VWA7 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 기반 PBS 버퍼에 보존제 포함. 인간에 대한 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA054262-100 Anti-VWA7 Antibody, von Willebrand factor A domain containing 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054262-25 Anti-VWA7 Antibody, von Willebrand factor A domain containing 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VWA7 Antibody
Anti-VWA7 Antibody
Target Information
- Target Protein: von Willebrand factor A domain containing 7
- Target Gene: VWA7
- Alternative Gene Names: C6orf27, G7c, NG37
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.
Product Description
- Type: Polyclonal Antibody
- Host: Rabbit
- Isotype: IgG
- Reactivity: Human
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
LVFSVDGLLQKITVRIHGDISSFWIKNPAGVSQGQEEGGGPLGHTRRFGQFWMVTMDDPPQTGTWEIQVTAEDTPGVRVQAQTSLDFLFHFGIPMEDGPHPGLYPLTQPVAG
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000007030 | 84% |
| Rat | ENSRNOG00000000860 | 83% |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



