CacheBy
Atlas Antibodies Anti-VWA5B2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWA5B2 Antibody

상품 한눈에 보기

Human VWA5B2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA036823-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036823-100 Anti-VWA5B2 Antibody, von Willebrand factor A domain containing 5B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036823-25 Anti-VWA5B2 Antibody, von Willebrand factor A domain containing 5B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWA5B2 Antibody

Anti-VWA5B2 Antibody

Target Information

  • Target Protein: von Willebrand factor A domain containing 5B2
  • Target Gene: VWA5B2
  • Alternative Gene Names: DKFZp761K032, LOC90113
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human VWA5B2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000046613 (80%)
  • Rat ENSRNOG00000001707 (75%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.