CacheBy
Atlas Antibodies Anti-VSIG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VSIG1 Antibody

상품 한눈에 보기

Human VSIG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. Orthogonal 및 Recombinant Expression 검증을 통해 높은 특이성과 재현성을 확보. Affinity purification으로 높은 순도 보장. 인간 시료에 반응성이 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036311-100 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036311-25 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VSIG1 Antibody

Anti-VSIG1 Antibody

V-set and immunoglobulin domain containing 1


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human VSIG1


Alternative Gene Names

  • MGC44287

Open Datasheet


Target Information

항목 내용
Target Protein V-set and immunoglobulin domain containing 1
Target Gene VSIG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000054219 (82%), Mouse ENSMUSG00000031430 (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.