Atlas Antibodies Anti-VSIG1 Antibody
상품 한눈에 보기
Human VSIG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. Orthogonal 및 Recombinant Expression 검증을 통해 높은 특이성과 재현성을 확보. Affinity purification으로 높은 순도 보장. 인간 시료에 반응성이 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VSIG1 Antibody
V-set and immunoglobulin domain containing 1
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human VSIG1
Alternative Gene Names
- MGC44287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | V-set and immunoglobulin domain containing 1 |
| Target Gene | VSIG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000054219 (82%), Mouse ENSMUSG00000031430 (79%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.