Atlas Antibodies Anti-VSIG1 Antibody

상품 한눈에 보기

Human VSIG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. Orthogonal 및 Recombinant Expression 검증을 통해 높은 특이성과 재현성을 확보. Affinity purification으로 높은 순도 보장. 인간 시료에 반응성이 확인됨.

카탈로그번호: HPA036311-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036311-100 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036311-25 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-VSIG1 Antibody

Anti-VSIG1 Antibody

V-set and immunoglobulin domain containing 1

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human VSIG1

Alternative Gene Names

MGC44287

Open Datasheet

Target Information

항목	내용
Target Protein	V-set and immunoglobulin domain containing 1
Target Gene	VSIG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000054219 (82%), Mouse ENSMUSG00000031430 (79%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand