CacheBy
Atlas Antibodies Anti-VRK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VRK3 Antibody

상품 한눈에 보기

인간 VRK3 단백질을 인식하는 폴리클로날 항체로, IHC와 ICC 분석에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 인체 반응성이 검증되었으며, 40% 글리세롤 기반 완충액에 보존됩니다.

카탈로그번호
HPA056489-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056489-100 Anti-VRK3 Antibody, vaccinia related kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056489-25 Anti-VRK3 Antibody, vaccinia related kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VRK3 Antibody

Anti-VRK3 Antibody

Target Information

  • Target Protein: Vaccinia related kinase 3
  • Target Gene: VRK3
  • Antigen Sequence:
    CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
    (Recombinant Protein Epitope Signature Tag, PrEST antigen sequence)
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human VRK3.

Open Datasheet (PDF)

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000026517 73%
Mouse ENSMUSG00000002205 68%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.