Atlas Antibodies Anti-VSIG1 Antibody

상품 한눈에 보기

Human VSIG1 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식. 인체 반응성 확인 및 교차종 정보 제공. 연구용 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001445-100 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001445-25 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

V-set and immunoglobulin domain containing 1

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human VSIG1

항목	내용
Target Protein	V-set and immunoglobulin domain containing 1
Target Gene	VSIG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000054219 (82%), Mouse ENSMUSG00000031430 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand