CacheBy
Atlas Antibodies Anti-VIL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VIL1 Antibody

상품 한눈에 보기

인간 VIL1 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 비교 검증을 통해 신뢰성 높은 단백질 발현 확인이 가능합니다. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006884-100 Anti-VIL1 Antibody, villin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006884-25 Anti-VIL1 Antibody, villin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VIL1 Antibody

Anti-VIL1 Antibody

Target Protein: villin 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human VIL1


Alternative Gene Names

D2S1471, VIL

Open Datasheet


Technical Specifications

항목 내용
Target Protein villin 1
Target Gene VIL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000015408 (87%), Mouse ENSMUSG00000026175 (86%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

PFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKE

제품 이미지

Enhanced Validation
IHC Independent
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.