원본

Atlas Antibodies Anti-VHL Antibody

상품 한눈에 보기

Human VHL 단백질을 인식하는 토끼 폴리클로날 항체로, von Hippel-Lindau 종양 억제 단백질 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 면역세포화학(ICC) 등 다양한 응용에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031632-100 Anti-VHL Antibody, von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031632-25 Anti-VHL Antibody, von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase

Polyclonal antibody against human VHL protein, suitable for research use.

항목	내용
Target Protein	von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase
Target Gene	VHL
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000098639 (49%), Rat ENSRNOG00000060098 (43%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet