CacheBy
Atlas Antibodies Anti-VIL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VIL1 Antibody

상품 한눈에 보기

Human VIL1 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합. 독립 항체 간 비교로 검증된 신뢰성 높은 데이터 제공. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 보장. Human에 반응하며 Rat, Mouse와 높은 상동성 보유.

카탈로그번호
HPA006885-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006885-100 Anti-VIL1 Antibody, villin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006885-25 Anti-VIL1 Antibody, villin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VIL1 Antibody

Anti-VIL1 Antibody

Target Protein: villin 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human VIL1


Alternative Gene Names

D2S1471, VIL

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKE

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Rat ENSRNOG00000015408 (87%)
    • Mouse ENSMUSG00000026175 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 실험 조건에 맞는 최적의 농도와 조건은 사용자가 직접 설정해야 합니다.

제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.