
Atlas Antibodies Anti-UPF3B Antibody
Human UPF3B 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. UPF3B 관련 유전자 연구 및 nonsense-mediated decay 연구에 활용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UPF3B Antibody
UPF3 regulator of nonsense transcripts homolog B (yeast)
Recommended Applications
- WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human UPF3B.
Alternative Gene Names
HUPF3B, MRX62, RENT3B, UPF3X
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UPF3 regulator of nonsense transcripts homolog B (yeast) |
| Target Gene | UPF3B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000039994 (80%), Mouse ENSMUSG00000036572 (80%) |
Antigen Sequence (AA):
AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UPK1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UPK1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UPF3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UPF3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UPF3B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|