CacheBy
Atlas Antibodies Anti-UPF3B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UPF3B Antibody

상품 한눈에 보기

Human UPF3B 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. UPF3B 관련 유전자 연구 및 nonsense-mediated decay 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001882-100 Anti-UPF3B Antibody, UPF3 regulator of nonsense transcripts homolog B (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001882-25 Anti-UPF3B Antibody, UPF3 regulator of nonsense transcripts homolog B (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UPF3B Antibody

Anti-UPF3B Antibody

UPF3 regulator of nonsense transcripts homolog B (yeast)

  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human UPF3B.

Alternative Gene Names

HUPF3B, MRX62, RENT3B, UPF3X

Open Datasheet

Target Information

항목 내용
Target Protein UPF3 regulator of nonsense transcripts homolog B (yeast)
Target Gene UPF3B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000039994 (80%), Mouse ENSMUSG00000036572 (80%)

Antigen Sequence (AA):
AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.