CacheBy
Atlas Antibodies Anti-UPF3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UPF3A Antibody

상품 한눈에 보기

Human UPF3A 단백질을 인식하는 토끼 폴리클로날 항체로, 비정상 전사체 조절 연구에 적합. IHC 등 다양한 응용에 사용 가능. PrEST 항원을 이용해 친화 정제됨. 휴먼에 특이적으로 반응하며, 글리세롤 보존 용액에 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061316-100 Anti-UPF3A Antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061316-25 Anti-UPF3A Antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UPF3A Antibody

Anti-UPF3A Antibody

Target: UPF3 regulator of nonsense transcripts homolog A (yeast)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 응용에 적합


Product Description

Polyclonal antibody against human UPF3A.


Alternative Gene Names

HUPF3A, RENT3A, UPF3

Open Datasheet


Target Information

항목 내용
Target Protein UPF3 regulator of nonsense transcripts homolog A (yeast)
Target Gene UPF3A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000017397 (47%), Mouse ENSMUSG00000038398 (46%)

Antigen Sequence (PrEST):
KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.