
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UPF3B Antibody
상품 한눈에 보기
Human UPF3B 단백질을 타깃으로 하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며, 독립 항체 간 비교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 40% 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001592-100 Anti-UPF3B Antibody, UPF3 regulator of nonsense transcripts homolog B (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001592-25 Anti-UPF3B Antibody, UPF3 regulator of nonsense transcripts homolog B (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UPF3B Antibody
Anti-UPF3B Antibody
UPF3 regulator of nonsense transcripts homolog B (yeast)
Recommended Applications
- Western Blot (WB) – Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human UPF3B
Alternative Gene Names
HUPF3B, MRX62, RENT3B, UPF3X
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UPF3 regulator of nonsense transcripts homolog B (yeast) |
| Target Gene | UPF3B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR |
Verified Species Reactivity
- Human
Interspecies Information
- Rat ENSRNOG00000039994 (80%)
- Mouse ENSMUSG00000036572 (80%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



