
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBE2Z Antibody
상품 한눈에 보기
Human UBE2Z 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown으로 유전적 검증 완료. 고순도 Affinity 정제 항체로 인간, 마우스, 랫트 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA007922-100 Anti-UBE2Z Antibody, ubiquitin-conjugating enzyme E2Z 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007922-25 Anti-UBE2Z Antibody, ubiquitin-conjugating enzyme E2Z 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBE2Z Antibody
Anti-UBE2Z Antibody
Target: ubiquitin-conjugating enzyme E2Z (UBE2Z)
Type: Polyclonal Antibody against Human UBE2Z
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human UBE2Z.
Validated for multiple applications with enhanced validation standards.
Alternative Gene Names
- FLJ13855
- USE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-conjugating enzyme E2Z |
| Target Gene | UBE2Z |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDS |
Species Reactivity
- Verified: Human, Mouse, Rat
- Interspecies Identity:
- Rat ENSRNOG00000006868 (100%)
- Mouse ENSMUSG00000014349 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



