
Atlas Antibodies Anti-UBE2Z Antibody
상품 한눈에 보기
Human UBE2Z 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown으로 유전적 검증 완료. 고순도 Affinity 정제 항체로 인간, 마우스, 랫트 반응 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBE2Z Antibody
Target: ubiquitin-conjugating enzyme E2Z (UBE2Z)
Type: Polyclonal Antibody against Human UBE2Z
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human UBE2Z.
Validated for multiple applications with enhanced validation standards.
Alternative Gene Names
- FLJ13855
- USE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-conjugating enzyme E2Z |
| Target Gene | UBE2Z |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDS |
Species Reactivity
- Verified: Human, Mouse, Rat
- Interspecies Identity:
- Rat ENSRNOG00000006868 (100%)
- Mouse ENSMUSG00000014349 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBE4A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2Z Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2W Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2W Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.