CacheBy
Atlas Antibodies Anti-UBE2W Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBE2W Antibody

상품 한눈에 보기

인간 UBE2W 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 고순도 IgG 형태로 PBS와 글리세롤 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045161-100 Anti-UBE2W Antibody, ubiquitin-conjugating enzyme E2W (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045161-25 Anti-UBE2W Antibody, ubiquitin-conjugating enzyme E2W (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBE2W Antibody

Anti-UBE2W Antibody

Target: ubiquitin-conjugating enzyme E2W (putative)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human UBE2W.

Alternative Gene Names

  • FLJ11011

Open Datasheet

Target Information

항목 내용
Target Protein ubiquitin-conjugating enzyme E2W (putative)
Target Gene UBE2W
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050465 (100%)
Mouse ENSMUSG00000025939 (99%)

Antigen Sequence

DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.