CacheBy
Atlas Antibodies Anti-UBE3B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBE3B Antibody

상품 한눈에 보기

Human UBE3B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol 완충액에 보존되어 있습니다. 인간에 대해 검증된 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041012-100 Anti-UBE3B Antibody, ubiquitin protein ligase E3B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041012-25 Anti-UBE3B Antibody, ubiquitin protein ligase E3B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBE3B Antibody

Anti-UBE3B Antibody

Target Information

  • Target Protein: ubiquitin protein ligase E3B
  • Target Gene: UBE3B
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000029577 (87%)
  • Rat ENSRNOG00000047219 (85%)

Product Description

Polyclonal antibody against human UBE3B.

Open Datasheet

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Material Safety Data Sheet

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.