Atlas Antibodies Anti-UBAP2L Antibody

상품 한눈에 보기

인간 UBAP2L 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. Rabbit 호스트, IgG 아이소타입. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035068-100 Anti-UBAP2L Antibody, ubiquitin associated protein 2-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035068-25 Anti-UBAP2L Antibody, ubiquitin associated protein 2-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ubiquitin Associated Protein 2-Like (UBAP2L)
Supplier: Atlas Antibodies

Polyclonal antibody against human UBAP2L.

KIAA0144, NICE-4

Target Protein: Ubiquitin Associated Protein 2-Like
Target Gene: UBAP2L
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
```

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS	Material Safety Data Sheet