
Atlas Antibodies Anti-UBAP2L Antibody
상품 한눈에 보기
인간 UBAP2L 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. Rabbit 호스트, IgG 아이소타입. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBAP2L Antibody
Target: Ubiquitin Associated Protein 2-Like (UBAP2L)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human UBAP2L.
Alternative Gene Names
KIAA0144, NICE-4
Target Information
- Target Protein: Ubiquitin Associated Protein 2-Like
- Target Gene: UBAP2L
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000042520): 100%
- Rat (ENSRNOG00000017990): 79%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBASH3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBAP2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBASH3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBAP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.