
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBAP2L Antibody
상품 한눈에 보기
인간 UBAP2L 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. Rabbit 호스트, IgG 아이소타입. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035068-100 Anti-UBAP2L Antibody, ubiquitin associated protein 2-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035068-25 Anti-UBAP2L Antibody, ubiquitin associated protein 2-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBAP2L Antibody
Anti-UBAP2L Antibody
Target: Ubiquitin Associated Protein 2-Like (UBAP2L)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human UBAP2L.
Alternative Gene Names
KIAA0144, NICE-4
Target Information
- Target Protein: Ubiquitin Associated Protein 2-Like
- Target Gene: UBAP2L
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000042520): 100%
- Rat (ENSRNOG00000017990): 79%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



