Atlas Antibodies Anti-UBASH3A Antibody

상품 한눈에 보기

Human UBASH3A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 신뢰성을 제공하며, ICC 등 다양한 응용에 적합합니다. Human에 대한 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035367-100 Anti-UBASH3A Antibody, ubiquitin associated and SH3 domain containing A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035367-25 Anti-UBASH3A Antibody, ubiquitin associated and SH3 domain containing A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Ubiquitin associated and SH3 domain containing A

면역세포화학(ICC)

Polyclonal Antibody against Human UBASH3A

항목	내용
Target Protein	ubiquitin associated and SH3 domain containing A
Target Gene	UBASH3A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000001167 (88%), Mouse ENSMUSG00000042345 (87%)

Antigen Sequence
LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand