
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBB Antibody
상품 한눈에 보기
Human UBB 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC 분석에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 반응성과 신뢰성을 제공합니다. 40% glycerol 기반의 PBS buffer에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049132-100 Anti-UBB Antibody, ubiquitin B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049132-25 Anti-UBB Antibody, ubiquitin B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBB Antibody
Anti-UBB Antibody
Target: Ubiquitin B (UBB)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ubiquitin B (UBB).
Alternative gene names: FLJ25987, MGC8385
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000019505 | 100% |
| Rat | ENSRNOG00000057823 | 100% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions for each application. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



