
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TUSC2 Antibody
상품 한눈에 보기
인간 TUSC2 단백질을 인식하는 고품질 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. 재조합 단백질 발현으로 검증되었으며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human 종에 반응하며 Rabbit 호스트에서 생산되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030116-100 Anti-TUSC2 Antibody, tumor suppressor candidate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030116-25 Anti-TUSC2 Antibody, tumor suppressor candidate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TUSC2 Antibody
Anti-TUSC2 Antibody
Tumor suppressor candidate 2 (TUSC2)
Recommended Applications
- Western Blot (WB): Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human TUSC2
Alternative Gene Names
C3orf11, FUS1, PAP, PDAP2
Target Information
- Target Protein: Tumor suppressor candidate 2
- Target Gene: TUSC2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVI
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000021528 | 93% |
| Mouse | ENSMUSG00000010054 | 92% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



