Atlas Antibodies Anti-TUSC3 Antibody

상품 한눈에 보기

인간 TUSC3 단백질을 인식하는 폴리클로날 항체. 종양 억제 유전자 연구에 적합. 토끼 유래 IgG로 PrEST 항원을 이용해 친화 정제됨. 인간에 특이적 반응성을 가지며 Rat, Mouse와 97% 서열 유사성.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049974-100 Anti-TUSC3 Antibody, tumor suppressor candidate 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049974-25 Anti-TUSC3 Antibody, tumor suppressor candidate 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TUSC3 Antibody

Anti-TUSC3 Antibody

Target: Tumor suppressor candidate 3 (TUSC3)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human TUSC3 (tumor suppressor candidate 3).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

MGC13453, MRT7, N33, OST3A

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000013061 (97%)
Mouse ENSMUSG00000039530 (97%)

Recommended Applications

Immunohistochemistry (IHC)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Store as recommended by supplier.
Safety	Contains sodium azide. Material Safety Data Sheet