Atlas Antibodies Anti-TUSC3 Antibody
상품 한눈에 보기
인간 TUSC3 단백질을 인식하는 폴리클로날 항체. 종양 억제 유전자 연구에 적합. 토끼 유래 IgG로 PrEST 항원을 이용해 친화 정제됨. 인간에 특이적 반응성을 가지며 Rat, Mouse와 97% 서열 유사성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TUSC3 Antibody
Target: Tumor suppressor candidate 3 (TUSC3)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TUSC3 (tumor suppressor candidate 3).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
MGC13453, MRT7, N33, OST3A
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000013061 (97%)
- Mouse ENSMUSG00000039530 (97%)
Recommended Applications
Immunohistochemistry (IHC)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Store as recommended by supplier. |
| Safety | Contains sodium azide. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.