CacheBy
Atlas Antibodies Anti-TUSC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TUSC1 Antibody

상품 한눈에 보기

Human TUSC1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 정제되었습니다. Human 반응성이 검증되었으며, 암 억제 후보 단백질 연구에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051426-100 Anti-TUSC1 Antibody, tumor suppressor candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051426-25 Anti-TUSC1 Antibody, tumor suppressor candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TUSC1 Antibody

Anti-TUSC1 Antibody

Target Information

  • Target Protein: Tumor suppressor candidate 1
  • Target Gene: TUSC1
  • Alternative Gene Names: TSG-9
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TUSC1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000054000 70%
Rat ENSRNOG00000018997 33%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.