
Atlas Antibodies Anti-GPT2 Antibody
상품 한눈에 보기
Human GPT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. ALT2로도 알려진 GPT2 단백질의 발현을 정밀하게 검증하며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 시료에서 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPT2 Antibody
Target: glutamic pyruvate transaminase (alanine aminotransferase) 2
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Orthogonal validation
Orthogonal validation:
Protein expression verified by WB, compared to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human GPT2 (ALT2).
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamic pyruvate transaminase (alanine aminotransferase) 2 |
| Target Gene | GPT2 |
| Alternative Gene Names | ALT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000059579 | 95% |
| Mouse | ENSMUSG00000031700 | 92% |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
