
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPT Antibody
상품 한눈에 보기
인간 GPT 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. ALT1/GPT1 유전자 타깃. Orthogonal validation으로 RNA-seq 데이터와 비교 검증. 친화 정제된 고품질 항체로 사람, 생쥐, 랫트 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031060-100 Anti-GPT Antibody, glutamic-pyruvate transaminase (alanine aminotransferase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031060-25 Anti-GPT Antibody, glutamic-pyruvate transaminase (alanine aminotransferase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPT Antibody
Anti-GPT Antibody
Target: glutamic-pyruvate transaminase (alanine aminotransferase)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - Western Blot (WB)
Product Description
Polyclonal Antibody against Human GPT
Alternative Gene Names
ALT1, GPT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamic-pyruvate transaminase (alanine aminotransferase) |
| Target Gene | GPT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000033915 (85%), Mouse ENSMUSG00000022546 (85%) |
Antigen Sequence:
MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



