
Atlas Antibodies Anti-GPT Antibody
상품 한눈에 보기
인간 GPT 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. ALT1/GPT1 유전자 타깃. Orthogonal validation으로 RNA-seq 데이터와 비교 검증. 친화 정제된 고품질 항체로 사람, 생쥐, 랫트 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPT Antibody
Target: glutamic-pyruvate transaminase (alanine aminotransferase)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - Western Blot (WB)
Product Description
Polyclonal Antibody against Human GPT
Alternative Gene Names
ALT1, GPT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamic-pyruvate transaminase (alanine aminotransferase) |
| Target Gene | GPT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000033915 (85%), Mouse ENSMUSG00000022546 (85%) |
Antigen Sequence:
MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
