CacheBy
Atlas Antibodies Anti-GPX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPX4 Antibody

상품 한눈에 보기

Human GPX4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 신뢰성 확보. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 버퍼에 보존. 인간 시료에 최적화된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047224-100 Anti-GPX4 Antibody, glutathione peroxidase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047224-25 Anti-GPX4 Antibody, glutathione peroxidase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPX4 Antibody

Anti-GPX4 Antibody

Target: Glutathione Peroxidase 4 (GPX4)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human GPX4.


Alternative Gene Names

MCSP, PHGPx

Open Datasheet


Target Information

항목 내용
Target Protein Glutathione peroxidase 4
Target Gene GPX4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000075706 (92%), Rat ENSRNOG00000013604 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.