
Atlas Antibodies Anti-GLYR1 Antibody
Human GLYR1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제됨. 인간 및 설치류 종에 높은 반응성을 보임.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GLYR1 Antibody
glyoxylate reductase 1 homolog (Arabidopsis)
Recommended Applications
- IHC (Independent antibody validation)
- ICC
Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to ensure specificity.
Product Description
Polyclonal Antibody against Human GLYR1
Alternative Gene Names
BM045, HIBDL, N-PAC, NP60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glyoxylate reductase 1 homolog (Arabidopsis) |
| Target Gene | GLYR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (98%), Rat (98%) |
Antigen Sequence:
IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GMCL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYCTK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYATL2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|