CacheBy
Atlas Antibodies Anti-GMCL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GMCL1 Antibody

상품 한눈에 보기

Human GMCL1 단백질을 인식하는 토끼 폴리클로날 항체로, 생식세포 관련 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 친화 정제됨. 고순도, 높은 특이성, 휴먼 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039579-100 Anti-GMCL1 Antibody, germ cell-less, spermatogenesis associated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039579-25 Anti-GMCL1 Antibody, germ cell-less, spermatogenesis associated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GMCL1 Antibody

Anti-GMCL1 Antibody

Target: germ cell-less, spermatogenesis associated 1 (GMCL1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GMCL1 protein.


Alternative Gene Names

BTBD13, FLJ13057, GCL1, SPATA29

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein germ cell-less, spermatogenesis associated 1
Target Gene GMCL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000017838 90%
Mouse ENSMUSG00000001157 89%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.