
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GLYR1 Antibody
상품 한눈에 보기
Human GLYR1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 ICC 응용에 적합. 독립 항체 검증을 통해 높은 특이성과 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 순도 보장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050136-100 Anti-GLYR1 Antibody, glyoxylate reductase 1 homolog (Arabidopsis) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050136-25 Anti-GLYR1 Antibody, glyoxylate reductase 1 homolog (Arabidopsis) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GLYR1 Antibody
Anti-GLYR1 Antibody
Target: glyoxylate reductase 1 homolog (Arabidopsis)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): 단백질 발현 검증을 위해 서로 다른 에피토프를 타깃하는 독립 항체와 비교하여 검증 수행
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human GLYR1
Alternative Gene Names
BM045, HIBDL, N-PAC, NP60
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | glyoxylate reductase 1 homolog (Arabidopsis) |
| Target Gene | GLYR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000003065 (98%), Mouse ENSMUSG00000022536 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



