CacheBy
Atlas Antibodies Anti-GLRA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLRA1 Antibody

상품 한눈에 보기

인간 GLRA1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016502-100 Anti-GLRA1 Antibody, glycine receptor, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016502-25 Anti-GLRA1 Antibody, glycine receptor, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLRA1 Antibody

Anti-GLRA1 Antibody

Target: Glycine receptor, alpha 1 (GLRA1)
Type: Polyclonal Antibody against Human GLRA1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody targeting the human GLRA1 (glycine receptor, alpha 1) protein.


Alternative Gene Names

  • STHE

Target Information

항목 내용
Target Protein Glycine receptor, alpha 1
Target Gene GLRA1
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000000263 (96%)
Rat ENSRNOG00000013588 (95%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.