CacheBy
Atlas Antibodies Anti-GLP2R Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLP2R Antibody

상품 한눈에 보기

인간 GLP2R 단백질을 표적으로 하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤과 PBS 버퍼에 보존되어 안정성이 우수함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049244-100 Anti-GLP2R Antibody, glucagon-like peptide 2 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049244-25 Anti-GLP2R Antibody, glucagon-like peptide 2 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLP2R Antibody

Anti-GLP2R Antibody

Target: Glucagon-like peptide 2 receptor (GLP2R)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GLP2R.

Open Datasheet (PDF)


Target Information

  • Target Protein: Glucagon-like peptide 2 receptor
  • Target Gene: GLP2R
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000003683 67%
Mouse ENSMUSG00000049928 59%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.