CacheBy
Atlas Antibodies Anti-GLRA4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLRA4 Antibody

상품 한눈에 보기

인간 GLRA4 단백질을 대상으로 한 폴리클로날 항체로, 토끼에서 생산된 IgG 형식의 항체입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. PBS와 글리세롤 버퍼로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044759-100 Anti-GLRA4 Antibody, glycine receptor, alpha 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044759-25 Anti-GLRA4 Antibody, glycine receptor, alpha 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLRA4 Antibody

Anti-GLRA4 Antibody

Target: Glycine receptor, alpha 4
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human GLRA4

Open Datasheet


Target Information

항목 내용
Target Protein Glycine receptor, alpha 4
Target Gene GLRA4
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000018595 (90%), Rat ENSRNOG00000002391 (81%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.