
Atlas Antibodies Anti-GGCX Antibody
상품 한눈에 보기
인간 GGCX 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합합니다. Rabbit에서 생산된 IgG 형태이며 PrEST 항원으로 정제되었습니다. 높은 종간 서열 유사성을 보여 인간, Rat, Mouse에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GGCX Antibody
Target Information
- Target Protein: gamma-glutamyl carboxylase
- Target Gene: GGCX
- Alternative Gene Names: VKCFD1
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against human GGCX.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000012975 (97%)
- Mouse ENSMUSG00000103019 (96%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
