CacheBy
Atlas Antibodies Anti-GGH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGH Antibody

상품 한눈에 보기

Human GGH를 인식하는 rabbit polyclonal antibody로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. PBS와 glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025226-100 Anti-GGH Antibody, gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025226-25 Anti-GGH Antibody, gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGH Antibody

Anti-GGH Antibody

Target Information

  • Target Protein: gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)
  • Target Gene: GGH
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000073987 (77%)
    • Rat ENSRNOG00000007351 (73%)

Product Description

Polyclonal antibody against Human GGH.

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Recommended Applications IHC, WB

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.