CacheBy
Atlas Antibodies Anti-GGCT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGCT Antibody

상품 한눈에 보기

인간 GGCT 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA020735-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020735-100 Anti-GGCT Antibody, gamma-glutamylcyclotransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020735-25 Anti-GGCT Antibody, gamma-glutamylcyclotransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGCT Antibody

Anti-GGCT Antibody

Target: gamma-glutamylcyclotransferase
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against Human GGCT.


Alternative Gene Names

C7orf24, CRF21, GCTG, Ggc, MGC3077

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein gamma-glutamylcyclotransferase
Target Gene GGCT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (86%), Rat (84%)

Antigen Sequence:
QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.