Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
GIRK2(Kir3.2) 단백질을 표적하는 Rabbit Polyclonal 항체로 Western Blot 및 IHC(F) 실험에 적합. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C 보관 권장.
- 카탈로그번호
- APC-006-xxxxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:200 |
| Immunohistochemistry (Frozen) (IHC (F)) | 1:400 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence ELANRAEVPLSWSVSSKLNQHAELETEEEEKNPEELTERNG, corresponding to residues 374–414 of mouse Kir3.2 (Intracellular, C-terminal domain) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Reconstitution: Add 25 µL, 50 µL, or 0.2 mL of double distilled water (DDW), depending on the sample size.
The antibody ships as a lyophilized powder at room temperature. Upon arrival, store at -20°C.
Reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, store small aliquots at -20°C.
Avoid multiple freeze/thaw cycles. Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
Potassium channels are present in most mammalian cells and are involved in various physiological responses.
The protein encoded by this gene is an integral membrane, inward-rectifier type potassium channel controlled by G-proteins.
It may play a role in glucose-regulated insulin secretion and forms a heteromultimeric pore-forming complex with other G-protein-activated potassium channels.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.