Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
GIRK2(Kir3.2) 단백질을 표적하는 Rabbit Polyclonal 항체로 Western Blot 및 IHC(F) 실험에 적합. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:200 |
| Immunohistochemistry (Frozen) (IHC (F)) | 1:400 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence ELANRAEVPLSWSVSSKLNQHAELETEEEEKNPEELTERNG, corresponding to residues 374–414 of mouse Kir3.2 (Intracellular, C-terminal domain) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.8 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Reconstitution: Add 25 µL, 50 µL, or 0.2 mL of double distilled water (DDW), depending on the sample size.
The antibody ships as a lyophilized powder at room temperature. Upon arrival, store at -20°C.
Reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, store small aliquots at -20°C.
Avoid multiple freeze/thaw cycles. Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
Potassium channels are present in most mammalian cells and are involved in various physiological responses.
The protein encoded by this gene is an integral membrane, inward-rectifier type potassium channel controlled by G-proteins.
It may play a role in glucose-regulated insulin secretion and forms a heteromultimeric pore-forming complex with other G-protein-activated potassium channels.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific KV3.2 (KCNC2) Polyclonal Antibody
923,800원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.2 (KCNA2) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
790,800원
Thermo Fisher Scientific
Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|