
Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
GIRK1(Kir3.1) 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공. 심장 박동 조절 관련 칼륨 채널 연구에 유용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1:200
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437–501 of mouse GIRK1 (Intracellular, C-terminus) |
| Target Family | Kir3.1 (KCNJ3) |
| UniProt ID | P63250-1 |
| Antigen Range | 437–501 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
- The antibody ships as a lyophilized powder at room temperature.
- Upon arrival, store at -20°C.
- The reconstituted solution can be stored at 4°C, protected from light, for up to 1 week.
- For longer storage, aliquot and keep at -20°C.
- Avoid multiple freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
This potassium channel is controlled by G proteins. Inward rectifier potassium channels preferentially allow potassium influx rather than efflux. Their voltage dependence is modulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts to more positive potentials. The inward rectification arises mainly from blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GIRK2 (Kir3.2) Polyclonal Antibody
790,800원

Thermo Fisher Scientific
Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.4 Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific KV1.5 (KCNA5) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|