CacheBy
Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
원본

Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody

상품 한눈에 보기

GIRK1(Kir3.1) 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공. 심장 박동 조절 관련 칼륨 채널 연구에 유용.

카탈로그번호
APC-005-xxxxx (3개 옵션)
판매단위
pk
카탈로그 보기

카탈로그

3개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 12:54
Thermo Fisher Scientific APC-005-200UL GIRK1 (Kir3.1) Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
1,121,200원VAT 포함 1,233,320원
Thermo Fisher Scientific APC-005-50UL GIRK1 (Kir3.1) Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
923,800원VAT 포함 1,016,180원
Thermo Fisher Scientific APC-005-25UL GIRK1 (Kir3.1) Polyclonal Antibody 25 ul pk판매 단위 pk ·
재고 확인 필요
742,000원VAT 포함 816,200원

Thermo Fisher Scientific · Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 1:200

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437–501 of mouse GIRK1 (Intracellular, C-terminus)
Target Family Kir3.1 (KCNJ3)
UniProt ID P63250-1
Antigen Range 437–501
Conjugate Unconjugated
Form Lyophilized
Concentration 0.6 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.4, with 1% BSA
Contains 0.05% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

  • Reconstitution: 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
  • The antibody ships as a lyophilized powder at room temperature.
  • Upon arrival, store at -20°C.
  • The reconstituted solution can be stored at 4°C, protected from light, for up to 1 week.
  • For longer storage, aliquot and keep at -20°C.
  • Avoid multiple freeze/thaw cycles.
  • Centrifuge all antibody preparations before use (10,000 × g, 5 min).

Target Information

This potassium channel is controlled by G proteins. Inward rectifier potassium channels preferentially allow potassium influx rather than efflux. Their voltage dependence is modulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts to more positive potentials. The inward rectification arises mainly from blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.


For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.