
원본
Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
상품 한눈에 보기
GIRK1(Kir3.1) 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 상태로 제공. 심장 박동 조절 관련 칼륨 채널 연구에 유용.
- 카탈로그번호
- APC-005-xxxxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 12:54
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific APC-005-200UL GIRK1 (Kir3.1) Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
1,121,200원VAT 포함 1,233,320원
Thermo Fisher Scientific APC-005-50UL GIRK1 (Kir3.1) Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
923,800원VAT 포함 1,016,180원
Thermo Fisher Scientific APC-005-25UL GIRK1 (Kir3.1) Polyclonal Antibody 25 ul pk판매 단위 pk ·
재고 확인 필요
742,000원VAT 포함 816,200원
Thermo Fisher Scientific · Thermo Fisher Scientific GIRK1 (Kir3.1) Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1:200
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437–501 of mouse GIRK1 (Intracellular, C-terminus) |
| Target Family | Kir3.1 (KCNJ3) |
| UniProt ID | P63250-1 |
| Antigen Range | 437–501 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: 25 µL, 50 µL, or 0.2 mL double distilled water (DDW), depending on sample size.
- The antibody ships as a lyophilized powder at room temperature.
- Upon arrival, store at -20°C.
- The reconstituted solution can be stored at 4°C, protected from light, for up to 1 week.
- For longer storage, aliquot and keep at -20°C.
- Avoid multiple freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
This potassium channel is controlled by G proteins. Inward rectifier potassium channels preferentially allow potassium influx rather than efflux. Their voltage dependence is modulated by extracellular potassium concentration; as external potassium increases, the voltage range for channel opening shifts to more positive potentials. The inward rectification arises mainly from blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
