Thermo Fisher Scientific LCK Polyclonal Antibody
LCK 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
- 카탈로그번호
- PA579587
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific LCK Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468–506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746702 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LCK is a member of the Src-family tyrosine kinases, essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates ITAM motifs in the zeta subunits, creating binding sites for the SH2 domains of ZAP70, which is subsequently phosphorylated and activated by LCK. Activated ZAP70 phosphorylates adaptor LAT, forming signaling platforms for downstream signaling.
Most LCK is localized to the plasma membrane, with a fraction associated with the Golgi apparatus, potentially contributing to Raf activation under weak TCR stimulation.
LCK contains N-terminal myristylation and palmitylation sites, a PTK domain, and SH2/SH3 domains for protein-protein interactions. It also regulates apoptosis induced by various stimuli, excluding death receptor pathways.
Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternative splice variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.