
Thermo Fisher Scientific LCK Polyclonal Antibody
LCK 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468–506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746702 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LCK is a member of the Src-family tyrosine kinases, essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates ITAM motifs in the zeta subunits, creating binding sites for the SH2 domains of ZAP70, which is subsequently phosphorylated and activated by LCK. Activated ZAP70 phosphorylates adaptor LAT, forming signaling platforms for downstream signaling.
Most LCK is localized to the plasma membrane, with a fraction associated with the Golgi apparatus, potentially contributing to Raf activation under weak TCR stimulation.
LCK contains N-terminal myristylation and palmitylation sites, a PTK domain, and SH2/SH3 domains for protein-protein interactions. It also regulates apoptosis induced by various stimuli, excluding death receptor pathways.
Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternative splice variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific NGAL Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NGAL Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific LCK Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NGAL Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific LCN1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|