Thermo Fisher Scientific LCK Polyclonal Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
PA579587 | - | Thermo Fisher Scientific PA579587 LCK Polyclonal Antibody 100 ug pk | 재고문의 | pk | 581,000원 | - | 639,100원 |
다른 상품 둘러보기
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Immunohistochemistry (Frozen) (IHC (F))
0.5-1 µg/mL
Immunocytochemistry (ICC/IF)
2 µg/mL
Flow Cytometry (Flow)
1-3 µg/1x10^6 cells
Product Specifications
Species Reactivity
Human, Mouse, Rat
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ).
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746702
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LCK is a member of the Src-family tyrosine kinase, which are essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates the ITAM motives in its zeta subunits establishing binding sites for the SH2 domains of the tyrosine kinase ZAP70, which is also phosphorylated by LCK and activated to generate subsequent signaling platforms by phosphorylation of adaptor LAT. The majority of LCK is localized to the plasma membrane, however, there is also a significant fraction associated with the Golgi apparatus which may contribute to Raf activation under conditions of weak stimulation through the TCR. LCK contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK is also involved in the regulation of apoptosis induced by various stimuli, but not by the death receptors. Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternatively splice variants of the LCK gene encoding different isoforms of the protein have been found.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|