Thermo Fisher Scientific IRF7 Polyclonal Antibody
IRF7 단백질을 검출하기 위한 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(P) 실험에 적합하며, 합성 펩타이드 면역원으로 제작됨. 비결합형, 동결건조 형태로 제공되며 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human IRF7 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746635 |
Product Specific Information
The synthetic peptide sequence is 31–67aa: QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR.
Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interferons (IFNs) play major roles in immune responses during viral infections, regulating both innate and adaptive antiviral mechanisms.
IRF7 is involved in transcriptional activation of virus-inducible genes, including interferon beta chain genes. It interacts with TLR adaptor proteins such as MyD88 and Tirp/TRAM, functioning as an intermediate in TLR4 and TLR9 signaling pathways.
There are at least four differentially spliced isoforms of IRF7, though their functions remain unclear.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IRF5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF7 Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF1 Polyclonal Antibody
621,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|