Thermo Fisher Scientific IRF7 Polyclonal Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
PA579519 | - | Thermo Fisher Scientific PA579519 IRF7 Polyclonal Antibody 100 ug pk | 재고문의 | pk | 0원 | - | 0원 |
다른 상품 둘러보기
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Product Specifications
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human IRF7.
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2746635
Product Specific Information
The synthetic peptide sequence is 31-67aa, QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Target Information
Interferons (IFNs) are involved in a multitude of immune interactions during viral infections and play a major role in both the induction and regulation of innate and adaptive antiviral mechanisms. During infection, host-virus interactions signal downstream molecules such as transcription factors such as IFN regulatory factor-3 (IRF3) which can act to stimulate transcription of IFN-a/b genes. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. IRF7 play a major role in the innate immune pathway, interacting with the Toll-like receptor (TLR) adaptor proteins MyD88 and Tirp/TRAM and functioning as an intermediate TLR4 and TLR9 signaling. There are at least four differentially spliced isoforms of IRF7, although their function has not been clearly established.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|