Thermo Fisher Scientific IRF7 Polyclonal Antibody
IRF7 단백질을 검출하기 위한 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 IHC(P) 실험에 적합하며, 합성 펩타이드 면역원으로 제작됨. 비결합형, 동결건조 형태로 제공되며 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IRF7 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human IRF7 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746635 |
Product Specific Information
The synthetic peptide sequence is 31–67aa: QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR.
Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interferons (IFNs) play major roles in immune responses during viral infections, regulating both innate and adaptive antiviral mechanisms.
IRF7 is involved in transcriptional activation of virus-inducible genes, including interferon beta chain genes. It interacts with TLR adaptor proteins such as MyD88 and Tirp/TRAM, functioning as an intermediate in TLR4 and TLR9 signaling pathways.
There are at least four differentially spliced isoforms of IRF7, though their functions remain unclear.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.