Thermo Fisher Scientific OGT Polyclonal Antibody
OGT 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, ICC, Flow cytometry 등 다양한 응용에 사용 가능. 합성 펩타이드 면역원 기반으로 제작되었으며, 고순도 친화 크로마토그래피 정제. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008–1046aa: NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long-term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2807122 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites or alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats required for optimal substrate recognition. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Urokinase Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific IL-1 beta Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific OGT Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CD14 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SOX4 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|