
Thermo Fisher Scientific OGT Polyclonal Antibody
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Immunocytochemistry (ICC/IF)
2 µg/mL
Flow Cytometry (Flow)
1-3 µg/1x10^6 cells
Product Specifications
Species Reactivity
Human, Mouse, Rat
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA). if (typeof window.$mangular === undefined || !window.$mangular) { window.$mangular = {}; } $mangular.antigenJson = \[{targetFamily:OGT,uniProtId:O15294-1,ncbiNodeId:9606,antigenRange:1008-1046,antigenLength:1046,antigenImageFileName:PA5-95319_OGT_O15294-1_Rabbit.svg,antigenImageFileNamePDP:PA5-95319_OGT_O15294-1_Rabbit_PDP.jpeg,sortOrder:1}\]; $mangular.isB2BCMGT = false; $mangular.isEpitopesModalImageMultiSizeEnabled = true;
View immunogen .st0{fill:#FFFFFF;} .st1{fill:#1E8AE7;}
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807122
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Urokinase Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific IL-1 beta Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific OGT Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific CD14 Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific SOX4 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
